Researchers only, not for human or animal consumption · 21+ only
Home / Catalog / Secretagogue Peptides / Tesamorelin
Tesamorelin research vial
Secretagogue Peptides

Tesamorelin

Stabilized GHRH(1-44) analog

≥99% HPLC HPLC-RTM Identity Published COA
$89
The lots on saleTested by ILS Laboratories
10mg
Lot
TSM10-2026-001
HPLC purity
99.89%
Net content
10.45 mg
Analyzed
06/11/2026

View certificate Laboratory's record ↗

20mg
Lot
TSM20-2026-001
HPLC purity
99.61%
Net content
20.49 mg
Analyzed
07/15/2026

View certificate Laboratory's record ↗

Select size · 2 options

$12 flat US shipping · free over $200

Need bulk or wholesale pricing? Request a volume quote

For research use only — not for human or veterinary use
Signed third-party COA — verify the lot with the issuing lab
Lyophilized & handled for stability
Damaged, mislabeled, or a COA that doesn't match the lot — refunded or replaced in full
Ships from Phoenix, AZ — same-day dispatch on in-stock orders
New to certificates? How to read a COA, field by field.

Overview

Tesamorelin is a synthetic analog of human growth hormone-releasing hormone (GHRH 1-44) in which the N-terminal tyrosine residue carries a trans-3-hexenoic acid (hexenoyl) modification. This acylation is intended to confer resistance to enzymatic degradation relative to native GHRH, making the molecule a useful tool for studying the GHRH receptor and downstream signaling in controlled in vitro and ex vivo systems. The peptide is supplied as a lyophilized powder for laboratory research use only.

As a member of the growth hormone secretagogue class, Tesamorelin is used in research settings to investigate the regulation of the somatotropic axis and pulsatile growth hormone release at the cellular and receptor level. It serves as a reference compound in structure-activity studies of GHRH analogs and in assays probing peptide stability, receptor binding kinetics, and second-messenger pathways. All characterization data are provided to support analytical and method-development work.

Research areas

  • GHRH receptor signaling studies
  • Somatotropic axis regulation models
  • Growth hormone secretagogue pharmacology
  • Peptide stability and proteolysis assays
  • Structure-activity relationship studies
  • Metabolic signaling pathway research

Handling & storage

Store lyophilized powder at -20C protected from light and moisture; stable for long-term storage. After reconstitution, store at 2-8C and use within a limited period; avoid repeated freeze-thaw cycles.

Reconstitute in sterile bacteriostatic or distilled water; the lyophilized peptide is readily soluble in aqueous buffer. Aliquot reconstituted stock to minimize freeze-thaw exposure. For laboratory research use only; not for human or veterinary use.

Specifications
FormLyophilized powder
Purity>=99% (HPLC)
Sequence(trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Molecular formulaC221H366N72O67S
Molecular weight5135.8 g/mol
CAS number218949-48-5
SynonymsTH9507, Egrifta (research reference name), GRF(1-44) analog, N-trans-3-hexenoyl-GHRH(1-44)
Certificate of Analysis

Signed third-party lab COAs — one per size, each independently verifiable with the issuing laboratory.

Tesamorelin COA — 10mg · Lot TSM10-2026-001 Tesamorelin COA — 20mg · Lot TSM20-2026-001 All certificates in the COA library

Compliance: Sold to qualified researchers for laboratory use only. Lot COA reflects the authoritative values for your specific shipment.

Tesamorelin in a set — save 15%

The same vials, each with its own certificate. The bundle price applies automatically when every vial of a set is in your cart; bundle pricing and codes don't combine — the cart applies whichever saves you more.

GLP-3 RT 10mg vialTesamorelin 10mg vialMOTS-c 10mg vial
3-vial bundle

The Apex Trio

GLP-3 RT, Tesamorelin and MOTS-c — three vials in one order, each with its own third-party COA.

  • GLP-3 RT 10mg · $70
  • Tesamorelin 10mg · $89
  • MOTS-c 10mg · $55
$181.90 $214 Save 15%

Bundle price: 15% off these 3 vials — applied automatically in the cart.

View
CJC-1295 + Ipamorelin Blend 10mg vialTesamorelin 10mg vialIGF-1 LR3 1mg vial
3-vial bundle

The Axis Trio

Three growth-signalling research compounds, together in one order.

  • CJC-1295 + Ipamorelin Blend 10mg · $89
  • Tesamorelin 10mg · $89
  • IGF-1 LR3 1mg · $85
$223.55 $263 Save 15%

Bundle price: 15% off these 3 vials — applied automatically in the cart.

View

Related compounds

More in Secretagogue Peptides
Secretagogue Peptides IGF-1 LR3 research vial

IGF-1 LR3

83-residue Long R3 IGF-1 analog with an N-terminal extension and Arg3 substitution, used as a reference standard in growth-factor signaling research.

≥99% HPLC 1mg
Price$85
View
Neuropeptides & CNS Signaling Selank research vial

Selank

Synthetic heptapeptide analog of tuftsin (TKPRPGP), used as a reference compound in neuro-immune and receptor signaling models. Laboratory research use only.

≥99% HPLC 10mg
Price$45
View
Neuropeptides & CNS Signaling Semax research vial

Semax

Synthetic ACTH(4-10)-derived heptapeptide with a stabilizing Pro-Gly-Pro motif, used in neurochemical and behavioral research models.

≥99% HPLC 10mg
Price$39
View
Start your research

Purity you can verify. Service you can trust.

Browse the catalog and check out securely. Signed third-party Certificates of Analysis are published for our compounds.

Shop Catalog Talk to the Team