For Research Use Only. Not for human or veterinary use. Free US shipping over $100 99%+ measured HPLC purity 7-step tested · signed third-party COA with every order
Certificate of Analysis

Tesamorelin — Certificate of Analysis

Tesamorelin — 10mg · lot TSM10-2026-001

Certificate of Analysis · PASS

Tesamorelin 10mg

Lot No.
TSM10-2026-001
Certificate No.
COA-2026-954069
Analysis date
06/11/2026
Labeled content
10mg
Date received
06/03/2026
Appearance
Good
Method
Full QC Panel
Laboratory
ILS Laboratories

Lot TSM10-2026-001 of Tesamorelin assayed at 99.89% peptide purity by RP-HPLC against a ≥95.0% release specification, 4.89 percentage points clear of it. Released 06/11/2026 by ILS Laboratories, ISO/IEC 17025 Accredited. Synthetic 44-residue human GHRH analog bearing an N-terminal trans-3-hexenoyl group; a research-grade growth hormone secretagogue.

Net peptide content measured 10.45 mg against a 10 mg label — the mass of actual peptide in the vial, as distinct from salts, water and counter-ions. It is reported rather than graded, so it carries no pass/fail.

Full QC panel

AnalyteSpecificationResultStatus
Peptide Purity (HPLC) ≥ 95.0% 99.89% Pass
Identity (HPLC-RTM) Tesamorelin Confirmed Confirmed Pass
Net Peptide Content Report Only 10.45 mg
Fentanyl Screen Immunoassay, 50 ng/mL cutoff Not Detected Pass

Sterility & endotoxin

TestSpecificationResultStatus
Sterility (PCR) No Growth No Growth Pass
Endotoxin (USP <85>) Report Result NMT 0.05 EU/mL Reported

Endotoxin is reported as a measured value rather than graded pass/fail: acceptable limits depend on route and matrix, and no universal threshold applies to research-use material. The laboratory reports the figure and leaves the judgement to you.

Elemental impurities

PanelMethodResultStatus
Arsenic, cadmium, chromium, lead, mercury ICP-MS, USP <233> 5 of 5 under limit Pass

Per-element measurements are on the signed certificate below and in the laboratory's own record.

Reference data

PropertyValue
CompoundTesamorelin
Also known asTH9507, Egrifta (research reference name), GRF(1-44) analog, N-trans-3-hexenoyl-GHRH(1-44)
Sequence(trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Molecular formulaC221H366N72O67S
Molecular weight5135.8 g/mol
CAS number218949-48-5
Physical formLyophilized powder
StorageStore lyophilized powder at -20C protected from light and moisture; stable for long-term storage. After reconstitution, store at 2-8C and use within a limited period; avoid repeated freeze-thaw cycles.
Dr. Greg Kalyuzhny
Laboratory Director, ILS Laboratories · issued 6/18/2026
Access code
FS5S8LM4

Check this certificate with the laboratory, not with us. Open the laboratory's own record of lot TSM10-2026-001 — a page we neither host nor control. Holding a vial already? Look up its lot number. For research use only.

The signed certificate

Tesamorelin — 20mg · lot TSM20-2026-001

Certificate of Analysis · PASS

Tesamorelin 20mg

Lot No.
TSM20-2026-001
Certificate No.
COA-2026-QTRMIQ
Analysis date
07/15/2026
Labeled content
20mg
Date received
07/01/2026
Appearance
Good
Method
Full QC Panel
Laboratory
ILS Laboratories

Lot TSM20-2026-001 of Tesamorelin assayed at 99.61% peptide purity by RP-HPLC against a ≥95.0% release specification, 4.61 percentage points clear of it. Released 07/15/2026 by ILS Laboratories, ISO/IEC 17025 Accredited. Synthetic 44-residue human GHRH analog bearing an N-terminal trans-3-hexenoyl group; a research-grade growth hormone secretagogue.

Net peptide content measured 20.49 mg against a 20 mg label — the mass of actual peptide in the vial, as distinct from salts, water and counter-ions. It is reported rather than graded, so it carries no pass/fail.

Full QC panel

AnalyteSpecificationResultStatus
Peptide Purity (HPLC) ≥ 95.0% 99.61% Pass
Identity (HPLC-RTM) Tesamorelin Confirmed Confirmed Pass
Net Peptide Content Report Only 20.49 mg
Fentanyl Screen Immunoassay, 50 ng/mL cutoff Not Detected Pass

Sterility & endotoxin

TestSpecificationResultStatus
Sterility (PCR) No Growth No Growth Pass
Endotoxin (USP <85>) Report Result NMT 0.05 EU/mL Reported

Endotoxin is reported as a measured value rather than graded pass/fail: acceptable limits depend on route and matrix, and no universal threshold applies to research-use material. The laboratory reports the figure and leaves the judgement to you.

Elemental impurities

PanelMethodResultStatus
Arsenic, cadmium, chromium, lead, mercury ICP-MS, USP <233> 5 of 5 under limit Pass

Per-element measurements are on the signed certificate below and in the laboratory's own record.

Reference data

PropertyValue
CompoundTesamorelin
Also known asTH9507, Egrifta (research reference name), GRF(1-44) analog, N-trans-3-hexenoyl-GHRH(1-44)
Sequence(trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Molecular formulaC221H366N72O67S
Molecular weight5135.8 g/mol
CAS number218949-48-5
Physical formLyophilized powder
StorageStore lyophilized powder at -20C protected from light and moisture; stable for long-term storage. After reconstitution, store at 2-8C and use within a limited period; avoid repeated freeze-thaw cycles.
Dr. Greg Kalyuzhny
Laboratory Director, ILS Laboratories · issued 7/15/2026
Access code
332L22HY

Check this certificate with the laboratory, not with us. Open the laboratory's own record of lot TSM20-2026-001 — a page we neither host nor control. Holding a vial already? Look up its lot number. For research use only.

The signed certificate