Tesamorelin — Certificate of Analysis
Tesamorelin — 10mg · lot TSM10-2026-001
Tesamorelin 10mg
Lot TSM10-2026-001 of Tesamorelin assayed at 99.89% peptide purity by RP-HPLC against a ≥95.0% release specification, 4.89 percentage points clear of it. Released 06/11/2026 by ILS Laboratories, ISO/IEC 17025 Accredited. Synthetic 44-residue human GHRH analog bearing an N-terminal trans-3-hexenoyl group; a research-grade growth hormone secretagogue.
Net peptide content measured 10.45 mg against a 10 mg label — the mass of actual peptide in the vial, as distinct from salts, water and counter-ions. It is reported rather than graded, so it carries no pass/fail.
Full QC panel
| Analyte | Specification | Result | Status |
|---|---|---|---|
| Peptide Purity (HPLC) | ≥ 95.0% | 99.89% | Pass |
| Identity (HPLC-RTM) | Tesamorelin Confirmed | Confirmed | Pass |
| Net Peptide Content | Report Only | 10.45 mg | — |
| Fentanyl Screen | Immunoassay, 50 ng/mL cutoff | Not Detected | Pass |
Sterility & endotoxin
| Test | Specification | Result | Status |
|---|---|---|---|
| Sterility (PCR) | No Growth | No Growth | Pass |
| Endotoxin (USP <85>) | Report Result | NMT 0.05 EU/mL | Reported |
Endotoxin is reported as a measured value rather than graded pass/fail: acceptable limits depend on route and matrix, and no universal threshold applies to research-use material. The laboratory reports the figure and leaves the judgement to you.
Elemental impurities
| Panel | Method | Result | Status |
|---|---|---|---|
| Arsenic, cadmium, chromium, lead, mercury | ICP-MS, USP <233> | 5 of 5 under limit | Pass |
Per-element measurements are on the signed certificate below and in the laboratory's own record.
Reference data
| Property | Value | ||
|---|---|---|---|
| Compound | Tesamorelin | ||
| Also known as | TH9507, Egrifta (research reference name), GRF(1-44) analog, N-trans-3-hexenoyl-GHRH(1-44) | ||
| Sequence | (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 | ||
| Molecular formula | C221H366N72O67S | ||
| Molecular weight | 5135.8 g/mol | ||
| CAS number | 218949-48-5 | ||
| Physical form | Lyophilized powder | ||
| Storage | Store lyophilized powder at -20C protected from light and moisture; stable for long-term storage. After reconstitution, store at 2-8C and use within a limited period; avoid repeated freeze-thaw cycles. | ||
Check this certificate with the laboratory, not with us. Open the laboratory's own record of lot TSM10-2026-001 — a page we neither host nor control. Holding a vial already? Look up its lot number. For research use only.
The signed certificate
Tesamorelin — 20mg · lot TSM20-2026-001
Tesamorelin 20mg
Lot TSM20-2026-001 of Tesamorelin assayed at 99.61% peptide purity by RP-HPLC against a ≥95.0% release specification, 4.61 percentage points clear of it. Released 07/15/2026 by ILS Laboratories, ISO/IEC 17025 Accredited. Synthetic 44-residue human GHRH analog bearing an N-terminal trans-3-hexenoyl group; a research-grade growth hormone secretagogue.
Net peptide content measured 20.49 mg against a 20 mg label — the mass of actual peptide in the vial, as distinct from salts, water and counter-ions. It is reported rather than graded, so it carries no pass/fail.
Full QC panel
| Analyte | Specification | Result | Status |
|---|---|---|---|
| Peptide Purity (HPLC) | ≥ 95.0% | 99.61% | Pass |
| Identity (HPLC-RTM) | Tesamorelin Confirmed | Confirmed | Pass |
| Net Peptide Content | Report Only | 20.49 mg | — |
| Fentanyl Screen | Immunoassay, 50 ng/mL cutoff | Not Detected | Pass |
Sterility & endotoxin
| Test | Specification | Result | Status |
|---|---|---|---|
| Sterility (PCR) | No Growth | No Growth | Pass |
| Endotoxin (USP <85>) | Report Result | NMT 0.05 EU/mL | Reported |
Endotoxin is reported as a measured value rather than graded pass/fail: acceptable limits depend on route and matrix, and no universal threshold applies to research-use material. The laboratory reports the figure and leaves the judgement to you.
Elemental impurities
| Panel | Method | Result | Status |
|---|---|---|---|
| Arsenic, cadmium, chromium, lead, mercury | ICP-MS, USP <233> | 5 of 5 under limit | Pass |
Per-element measurements are on the signed certificate below and in the laboratory's own record.
Reference data
| Property | Value | ||
|---|---|---|---|
| Compound | Tesamorelin | ||
| Also known as | TH9507, Egrifta (research reference name), GRF(1-44) analog, N-trans-3-hexenoyl-GHRH(1-44) | ||
| Sequence | (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 | ||
| Molecular formula | C221H366N72O67S | ||
| Molecular weight | 5135.8 g/mol | ||
| CAS number | 218949-48-5 | ||
| Physical form | Lyophilized powder | ||
| Storage | Store lyophilized powder at -20C protected from light and moisture; stable for long-term storage. After reconstitution, store at 2-8C and use within a limited period; avoid repeated freeze-thaw cycles. | ||
Check this certificate with the laboratory, not with us. Open the laboratory's own record of lot TSM20-2026-001 — a page we neither host nor control. Holding a vial already? Look up its lot number. For research use only.
The signed certificate
More certificates: IGF-1 LR3 · Retatrutide (LY3437943) · BPC-157 · Tirzepatide · all published lots
